GeneModel BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002706-TA|BGIBMGA002706-PA|undefined
         (103 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0033 + 12530311-12531264                                         27   2.8  

>12_02_0033 + 12530311-12531264
          Length = 317

 Score = 27.1 bits (57), Expect = 2.8
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 47  HRHMSIVLDRSVGVCIRLHAITNFNKNYLQHTTQTAE--CCTNVKP 90
           H H  I L   V + + L    + N + L+H  Q+ +  C TNV P
Sbjct: 173 HPHGGIELPDEVFIIVLLQGDNSINAHSLEHLLQSHKLWCLTNVPP 218


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.323    0.133    0.394 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,184,887
Number of Sequences: 37544
Number of extensions: 63582
Number of successful extensions: 119
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 119
Number of HSP's gapped (non-prelim): 1
length of query: 103
length of database: 14,793,348
effective HSP length: 71
effective length of query: 32
effective length of database: 12,127,724
effective search space: 388087168
effective search space used: 388087168
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 53 (25.4 bits)