Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002704-TA|BGIBMGA002704-PA|IPR002345|Lipocalin,
IPR011038|Calycin-like, IPR013208|Lipocalin-like
         (170 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                23   2.1  

>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 22.6 bits (46), Expect = 2.1
 Identities = 12/47 (25%), Positives = 23/47 (48%)

Query: 103 DTDYDNYAVVWSCYEFGIFHTVNSWILTRQQNPPKSVLDAAYDAIDK 149
           D +Y    + W+  E G+F  V+S  ++R     K+  D  Y+ + +
Sbjct: 470 DREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGR 516


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.138    0.436 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 52,103
Number of Sequences: 429
Number of extensions: 1945
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 170
length of database: 140,377
effective HSP length: 54
effective length of query: 116
effective length of database: 117,211
effective search space: 13596476
effective search space used: 13596476
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 41 (20.6 bits)