GeneModel BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002699-TA|BGIBMGA002699-PA|undefined
         (75 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_01_0508 + 6647812-6647820,6647864-6648226,6649351-6650673,665...    25   5.9  

>04_01_0508 + 6647812-6647820,6647864-6648226,6649351-6650673,
            6653569-6653766,6654485-6654568,6655175-6655920,
            6656480-6657341
          Length = 1194

 Score = 25.4 bits (53), Expect = 5.9
 Identities = 10/30 (33%), Positives = 20/30 (66%)

Query: 1    MPIIIENIPHKSSLATIVTHNESARLAGDA 30
            +P+  +N+  +S++ T +T +ES R  G+A
Sbjct: 1052 VPVYYKNLMARSAMLTCLTDSESQRANGNA 1081


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.316    0.131    0.372 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,459,683
Number of Sequences: 37544
Number of extensions: 27584
Number of successful extensions: 51
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 50
Number of HSP's gapped (non-prelim): 1
length of query: 75
length of database: 14,793,348
effective HSP length: 54
effective length of query: 21
effective length of database: 12,765,972
effective search space: 268085412
effective search space used: 268085412
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 52 (25.0 bits)