BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002693-TA|BGIBMGA002693-PA|IPR006162|Phosphopantetheine
attachment site, IPR001849|Pleckstrin-like,
IPR001331|Guanine-nucleotide dissociation stimulator, CDC24,
IPR000219|DH
(749 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CY... 25 5.5
>AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450
CYP4G16 protein.
Length = 151
Score = 25.4 bits (53), Expect = 5.5
Identities = 11/34 (32%), Positives = 18/34 (52%)
Query: 406 LVGQADVLFGNLHELFTFHQDVFLKDLERCISAT 439
++ + D +FG TF + +K LERC+ T
Sbjct: 34 VIQELDEIFGESDRPATFQDTLEMKYLERCLMET 67
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.318 0.132 0.396
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 747,568
Number of Sequences: 2123
Number of extensions: 29200
Number of successful extensions: 56
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 55
Number of HSP's gapped (non-prelim): 1
length of query: 749
length of database: 516,269
effective HSP length: 69
effective length of query: 680
effective length of database: 369,782
effective search space: 251451760
effective search space used: 251451760
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 51 (24.6 bits)
- SilkBase 1999-2023 -