GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002693-TA|BGIBMGA002693-PA|IPR006162|Phosphopantetheine
attachment site, IPR001849|Pleckstrin-like,
IPR001331|Guanine-nucleotide dissociation stimulator, CDC24,
IPR000219|DH
         (749 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY062189-1|AAL58550.1|  151|Anopheles gambiae cytochrome P450 CY...    25   5.5  

>AY062189-1|AAL58550.1|  151|Anopheles gambiae cytochrome P450
           CYP4G16 protein.
          Length = 151

 Score = 25.4 bits (53), Expect = 5.5
 Identities = 11/34 (32%), Positives = 18/34 (52%)

Query: 406 LVGQADVLFGNLHELFTFHQDVFLKDLERCISAT 439
           ++ + D +FG      TF   + +K LERC+  T
Sbjct: 34  VIQELDEIFGESDRPATFQDTLEMKYLERCLMET 67


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.318    0.132    0.396 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 747,568
Number of Sequences: 2123
Number of extensions: 29200
Number of successful extensions: 56
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 55
Number of HSP's gapped (non-prelim): 1
length of query: 749
length of database: 516,269
effective HSP length: 69
effective length of query: 680
effective length of database: 369,782
effective search space: 251451760
effective search space used: 251451760
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 51 (24.6 bits)