SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002691-TA|BGIBMGA002691-PA|undefined
         (566 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC101337-1|AAI01338.1|  365|Homo sapiens MGC21874 protein protein.     34   1.2  

>BC101337-1|AAI01338.1|  365|Homo sapiens MGC21874 protein protein.
          Length = 365

 Score = 34.3 bits (75), Expect = 1.2
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 239 GRKVCLEAFLYLENVTHYQLKRIRQHVMTHGVAPRIHGNVGK 280
           G+K C+      +   H    R  Q VM H V+  IHGN+GK
Sbjct: 25  GKKYCVYCLAEEDMAAHVGASRTPQEVMEHYVSMYIHGNLGK 66


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.315    0.132    0.389 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 66,316,629
Number of Sequences: 224733
Number of extensions: 2711818
Number of successful extensions: 5284
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5283
Number of HSP's gapped (non-prelim): 1
length of query: 566
length of database: 73,234,838
effective HSP length: 94
effective length of query: 472
effective length of database: 52,109,936
effective search space: 24595889792
effective search space used: 24595889792
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 68 (31.5 bits)

- SilkBase 1999-2023 -