SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002686-TA|BGIBMGA002686-PA|undefined
         (212 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC6F6.13c |||DUF726 family protein|Schizosaccharomyces pombe|c...    26   4.7  

>SPAC6F6.13c |||DUF726 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 778

 Score = 25.8 bits (54), Expect = 4.7
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 18  IKVDTLLFIKLSVDAKNRKPFIASVCRLLVKRHVPGLQC 56
           I +D+ L I  ++ ++  K   A VCRLL+ + V  + C
Sbjct: 136 ISMDSQLEITGNILSETEKMAYAGVCRLLILKMVDKIAC 174


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.324    0.141    0.445 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 575,314
Number of Sequences: 5004
Number of extensions: 17499
Number of successful extensions: 35
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 34
Number of HSP's gapped (non-prelim): 1
length of query: 212
length of database: 2,362,478
effective HSP length: 70
effective length of query: 142
effective length of database: 2,012,198
effective search space: 285732116
effective search space used: 285732116
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -