GeneModel BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002686-TA|BGIBMGA002686-PA|undefined
         (212 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_03_0102 - 12377512-12377737,12378250-12378374,12378756-123789...    29   3.7  

>09_03_0102 -
           12377512-12377737,12378250-12378374,12378756-12378941,
           12379469-12379609,12379972-12380114,12380515-12380707
          Length = 337

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 8   WHRVAYLEFPIKVDTLLFIKLSVDAKNRKPFIASV 42
           W+  AYL FP+ +D  LF    V  ++RK F +++
Sbjct: 118 WNHEAYLLFPVYIDGTLFDNAKV-MQSRKEFYSTI 151


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.324    0.141    0.445 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,822,955
Number of Sequences: 37544
Number of extensions: 127379
Number of successful extensions: 168
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 168
Number of HSP's gapped (non-prelim): 1
length of query: 212
length of database: 14,793,348
effective HSP length: 79
effective length of query: 133
effective length of database: 11,827,372
effective search space: 1573040476
effective search space used: 1573040476
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 58 (27.5 bits)