GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002682-TA|BGIBMGA002682-PA|IPR002192|Pyruvate phosphate
dikinase, PEP/pyruvate-binding
         (882 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF070443-1|AAG43168.1|  408|Homo sapiens GlcNAc-1-P transferase ...    33   5.9  

>AF070443-1|AAG43168.1|  408|Homo sapiens GlcNAc-1-P transferase
           protein.
          Length = 408

 Score = 32.7 bits (71), Expect = 5.9
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 672 RWTEEELLHEVDSPIMADNELTTFGNTGEVLPKPVTPL 709
           RW  + LLH   S  +     T FGNT  V+PKP  P+
Sbjct: 121 RWRHKLLLHTAASLPLLMVYFTNFGNTTIVVPKPFRPI 158


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.318    0.134    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 126,348,550
Number of Sequences: 224733
Number of extensions: 5435372
Number of successful extensions: 14404
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14403
Number of HSP's gapped (non-prelim): 1
length of query: 882
length of database: 73,234,838
effective HSP length: 96
effective length of query: 786
effective length of database: 51,660,470
effective search space: 40605129420
effective search space used: 40605129420
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 70 (32.3 bits)