GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002680-TA|BGIBMGA002680-PA|undefined
         (361 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF265297-1|AAG17640.1|  125|Tribolium castaneum putative cytochr...    26   0.48 

>AF265297-1|AAG17640.1|  125|Tribolium castaneum putative cytochrome
           P450 monooxigenase protein.
          Length = 125

 Score = 25.8 bits (54), Expect = 0.48
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 280 FSDAEETMNDNELPDYKEDGVDLEMQMADRIEKKNIRL 317
           F + EET +D+  PDYK      E++  +R  K+ +RL
Sbjct: 23  FEEIEETFSDDTKPDYKS---LQELKYMERCIKEVLRL 57


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.315    0.131    0.373 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,968
Number of Sequences: 317
Number of extensions: 2896
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 361
length of database: 114,650
effective HSP length: 58
effective length of query: 303
effective length of database: 96,264
effective search space: 29167992
effective search space used: 29167992
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 44 (21.8 bits)