BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002668-TA|BGIBMGA002668-PA|IPR000437|Prokaryotic
membrane lipoprotein lipid attachment site
(207 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 6.3
>DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated
ion channel subunit protein.
Length = 510
Score = 21.4 bits (43), Expect = 6.3
Identities = 10/36 (27%), Positives = 16/36 (44%)
Query: 150 VYQNIVQTLEDGIAFLDTFLNPNKGNSTPTAASSTV 185
V +NI LE+ + + P G TPT + +
Sbjct: 33 VSRNITMVLENLLMNYENNQLPTHGKGTPTVVKTNI 68
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.316 0.133 0.389
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 50,790
Number of Sequences: 429
Number of extensions: 1663
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 207
length of database: 140,377
effective HSP length: 55
effective length of query: 152
effective length of database: 116,782
effective search space: 17750864
effective search space used: 17750864
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 42 (21.0 bits)
- SilkBase 1999-2023 -