BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002658-TA|BGIBMGA002658-PA|IPR008516|Protein of unknown
function DUF798
(426 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 24 2.4
>AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2
protein protein.
Length = 301
Score = 23.8 bits (49), Expect = 2.4
Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%)
Query: 342 TNSARNYNTNVPTYDNIENVYDRGQMNTNYDGRIDTV-GGCESPSYGYGDSEW 393
TNS N N P Y N++ + ++ + ++T G S + +S W
Sbjct: 246 TNSTTNCYNNYPYYSNMDYLSSSTMSHSQFGNGLETSWGKSRDESSWFYNSGW 298
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.316 0.134 0.435
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,223
Number of Sequences: 317
Number of extensions: 3647
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 426
length of database: 114,650
effective HSP length: 59
effective length of query: 367
effective length of database: 95,947
effective search space: 35212549
effective search space used: 35212549
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -