SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002658-TA|BGIBMGA002658-PA|IPR008516|Protein of unknown
function DUF798
         (426 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY081778-1|AAL91655.1|  507|Anopheles gambiae cytochrome P450 pr...    24   9.1  

>AY081778-1|AAL91655.1|  507|Anopheles gambiae cytochrome P450
           protein.
          Length = 507

 Score = 23.8 bits (49), Expect = 9.1
 Identities = 10/39 (25%), Positives = 20/39 (51%)

Query: 265 VSYHVPRNEETVSEIVNNAYEPAPQVESVPIVVNRNNTI 303
           V+Y +  N + +  ++N      P +ES+  V  R+ T+
Sbjct: 352 VTYDMVMNVQYLDSVINETLRKYPPIESLSRVPMRDYTV 390


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.316    0.134    0.435 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 376,837
Number of Sequences: 2123
Number of extensions: 13832
Number of successful extensions: 17
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 1
length of query: 426
length of database: 516,269
effective HSP length: 66
effective length of query: 360
effective length of database: 376,151
effective search space: 135414360
effective search space used: 135414360
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 49 (23.8 bits)

- SilkBase 1999-2023 -