BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002658-TA|BGIBMGA002658-PA|IPR008516|Protein of unknown
function DUF798
(426 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 9.1
>AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450
protein.
Length = 507
Score = 23.8 bits (49), Expect = 9.1
Identities = 10/39 (25%), Positives = 20/39 (51%)
Query: 265 VSYHVPRNEETVSEIVNNAYEPAPQVESVPIVVNRNNTI 303
V+Y + N + + ++N P +ES+ V R+ T+
Sbjct: 352 VTYDMVMNVQYLDSVINETLRKYPPIESLSRVPMRDYTV 390
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.316 0.134 0.435
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 376,837
Number of Sequences: 2123
Number of extensions: 13832
Number of successful extensions: 17
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 1
length of query: 426
length of database: 516,269
effective HSP length: 66
effective length of query: 360
effective length of database: 376,151
effective search space: 135414360
effective search space used: 135414360
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 49 (23.8 bits)
- SilkBase 1999-2023 -