BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002657-TA|BGIBMGA002657-PA|undefined
(256 letters)
Database: fruitfly
52,641 sequences; 24,830,863 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014297-1754|AAF54984.1| 1481|Drosophila melanogaster CG14365-P... 29 6.3
>AE014297-1754|AAF54984.1| 1481|Drosophila melanogaster CG14365-PA
protein.
Length = 1481
Score = 29.1 bits (62), Expect = 6.3
Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 8/73 (10%)
Query: 76 LWAPAVPFSTTPACTVNTSSFSCHLHTNGAFTLERSKSDVQAYKHCRTEFIQKATFYTNE 135
L PA P A T++ S++SC L T R+ SD+ Y+ R Q+ T +N
Sbjct: 948 LLVPATPPQQHHARTLSDSNYSCQL----TDTSSRTSSDLDLYR--RRGQQQRCT--SNN 999
Query: 136 SKPKSEKDEECTF 148
S P S ++E F
Sbjct: 1000 SLPLSSENESVEF 1012
Database: fruitfly
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 24,830,863
Number of sequences in database: 52,641
Lambda K H
0.316 0.130 0.387
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,675,635
Number of Sequences: 52641
Number of extensions: 514351
Number of successful extensions: 1549
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1549
Number of HSP's gapped (non-prelim): 1
length of query: 256
length of database: 24,830,863
effective HSP length: 83
effective length of query: 173
effective length of database: 20,461,660
effective search space: 3539867180
effective search space used: 3539867180
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 61 (28.7 bits)
- SilkBase 1999-2023 -