GeneModel BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002651-TA|BGIBMGA002651-PA|IPR013132|N-acetylneuraminic
acid synthase, N-terminal
         (349 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z99281-47|CAC70123.2|  222|Caenorhabditis elegans Hypothetical p...    29   6.5  

>Z99281-47|CAC70123.2|  222|Caenorhabditis elegans Hypothetical
           protein Y57G11C.34 protein.
          Length = 222

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 96  ELFRYAQEVGILFTASAMDM----VSFDFLVNLKVPFIKIGSGDSNNLLFLKYAASKKIP 151
           +L R+AQ+  I  T S  +M    V  D + N++     + S D  N LFLK   S   P
Sbjct: 4   KLARFAQKRWISSTTSTSNMYDPRVFRDPVTNVQELRKPLDSDDERNFLFLKAMKSDATP 63

Query: 152 LIISTGMVDK 161
           +     ++DK
Sbjct: 64  VFYRDHVIDK 73


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.318    0.137    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,218,661
Number of Sequences: 27539
Number of extensions: 325920
Number of successful extensions: 583
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 583
Number of HSP's gapped (non-prelim): 1
length of query: 349
length of database: 12,573,161
effective HSP length: 82
effective length of query: 267
effective length of database: 10,314,963
effective search space: 2754095121
effective search space used: 2754095121
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 60 (28.3 bits)