GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002649-TA|BGIBMGA002649-PA|IPR011030|Lipovitellin,
superhelical, IPR000357|HEAT, IPR013932|TATA-binding protein
interacting (TIP20)
         (1273 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    25   3.0  

>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
            receptor beta1subunit protein.
          Length = 520

 Score = 25.4 bits (53), Expect = 3.0
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 1075 HNKPSLVRDLLPQVLPTIYAETKVKKELIR 1104
            H  P L+R +  + LPTI    + KK  +R
Sbjct: 328  HRMPQLIRKIFLKYLPTILMMRRPKKTRLR 357


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.322    0.135    0.389 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 289,464
Number of Sequences: 429
Number of extensions: 10192
Number of successful extensions: 24
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 23
Number of HSP's gapped (non-prelim): 1
length of query: 1273
length of database: 140,377
effective HSP length: 66
effective length of query: 1207
effective length of database: 112,063
effective search space: 135260041
effective search space used: 135260041
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 49 (23.8 bits)