GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002645-TA|BGIBMGA002645-PA|IPR006025|Peptidase M,
neutral zinc metallopeptidases, zinc-binding site, IPR001590|Peptidase
M12B, ADAM/reprolysin
         (622 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z69981-1|CAA93821.1|  327|Anopheles gambiae maltase precursor pr...    28   0.64 

>Z69981-1|CAA93821.1|  327|Anopheles gambiae maltase precursor
           protein.
          Length = 327

 Score = 28.3 bits (60), Expect = 0.64
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 4/50 (8%)

Query: 454 DAAPWSGGGDQRGQCAQLACRTPHRAGFFYAGPALPGTACGNKMWCQGGE 503
           D A  + G D   + ++  CRTP    F +  PA+ G   G+K W   G+
Sbjct: 138 DPAACNAGKDLYAEKSRDPCRTP----FQWDDPAMAGFTTGSKTWLPVGD 183


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.319    0.135    0.429 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 662,000
Number of Sequences: 2123
Number of extensions: 29497
Number of successful extensions: 29
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 28
Number of HSP's gapped (non-prelim): 1
length of query: 622
length of database: 516,269
effective HSP length: 68
effective length of query: 554
effective length of database: 371,905
effective search space: 206035370
effective search space used: 206035370
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 51 (24.6 bits)