SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002624-TA|BGIBMGA002624-PA|undefined
         (1052 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote...    25   7.9  

>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
           protein.
          Length = 1645

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 285 ASDIPVVQTTENIAIISSINTEKYEPVAII 314
           +SD+  V+ TE + + ++INT +   + II
Sbjct: 775 SSDVECVERTERLKVKTTINTSRIPSMCII 804


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.135    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,012,737
Number of Sequences: 2123
Number of extensions: 42321
Number of successful extensions: 93
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 91
Number of HSP's gapped (non-prelim): 2
length of query: 1052
length of database: 516,269
effective HSP length: 71
effective length of query: 981
effective length of database: 365,536
effective search space: 358590816
effective search space used: 358590816
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -