BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002624-TA|BGIBMGA002624-PA|undefined
(1052 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 7.9
>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
protein.
Length = 1645
Score = 25.4 bits (53), Expect = 7.9
Identities = 10/30 (33%), Positives = 19/30 (63%)
Query: 285 ASDIPVVQTTENIAIISSINTEKYEPVAII 314
+SD+ V+ TE + + ++INT + + II
Sbjct: 775 SSDVECVERTERLKVKTTINTSRIPSMCII 804
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.317 0.135 0.402
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,012,737
Number of Sequences: 2123
Number of extensions: 42321
Number of successful extensions: 93
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 91
Number of HSP's gapped (non-prelim): 2
length of query: 1052
length of database: 516,269
effective HSP length: 71
effective length of query: 981
effective length of database: 365,536
effective search space: 358590816
effective search space used: 358590816
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 53 (25.4 bits)
- SilkBase 1999-2023 -