SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002608-TA|BGIBMGA002608-PA|undefined
         (79 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC006674-13|AAF39942.1|  281|Caenorhabditis elegans Hypothetical...    28   0.90 

>AC006674-13|AAF39942.1|  281|Caenorhabditis elegans Hypothetical
          protein K12H6.7 protein.
          Length = 281

 Score = 27.9 bits (59), Expect = 0.90
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 44 LGPVLAPHYRCHLLIYG--RPFAFNCYELLVLADDVS 78
          LGPV   H   HL I    RP  +N YEL    DD++
Sbjct: 53 LGPVKQFHEAIHLCITSLYRPTPYNKYELTTNVDDLT 89


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.331    0.144    0.525 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,486,033
Number of Sequences: 27539
Number of extensions: 34621
Number of successful extensions: 53
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 53
Number of HSP's gapped (non-prelim): 1
length of query: 79
length of database: 12,573,161
effective HSP length: 59
effective length of query: 20
effective length of database: 10,948,360
effective search space: 218967200
effective search space used: 218967200
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.9 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -