SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002606-TA|BGIBMGA002606-PA|undefined
         (491 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    24   3.3  

>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 23.8 bits (49), Expect = 3.3
 Identities = 13/58 (22%), Positives = 24/58 (41%)

Query: 405 TPKALHKDMQDKALQVLLKMMKDNPSKELAKRNNYAMNYAVGANELETASNLVPFLPV 462
           T K   +D  ++      K++    +K +   NNY  NY     +L    N +  +P+
Sbjct: 62  TSKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNNCKKLYYNINYIEQIPI 119


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.316    0.131    0.372 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,560
Number of Sequences: 429
Number of extensions: 4399
Number of successful extensions: 10
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 9
Number of HSP's gapped (non-prelim): 1
length of query: 491
length of database: 140,377
effective HSP length: 60
effective length of query: 431
effective length of database: 114,637
effective search space: 49408547
effective search space used: 49408547
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 46 (22.6 bits)

- SilkBase 1999-2023 -