GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002604-TA|BGIBMGA002604-PA|IPR006616|Protein of unknown
function DM9
         (443 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    22   10.0 

>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 21.8 bits (44), Expect = 10.0
 Identities = 9/34 (26%), Positives = 13/34 (38%)

Query: 59  NAKSVIRKNRTKPDKVEIESPGILNGGEYRGFWV 92
           NA S++  NR  P K          G  +  F +
Sbjct: 734 NATSLVESNRNVPQKCIFNGQAYFPGSRFHPFLI 767


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.140    0.459 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 106,819
Number of Sequences: 317
Number of extensions: 4976
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 443
length of database: 114,650
effective HSP length: 59
effective length of query: 384
effective length of database: 95,947
effective search space: 36843648
effective search space used: 36843648
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)