GeneModel BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002604-TA|BGIBMGA002604-PA|IPR006616|Protein of unknown
function DM9
         (443 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z81124-1|CAB03369.1|  312|Caenorhabditis elegans Hypothetical pr...    29   6.6  

>Z81124-1|CAB03369.1|  312|Caenorhabditis elegans Hypothetical
           protein T21B4.2 protein.
          Length = 312

 Score = 29.1 bits (62), Expect = 6.6
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 372 GGPNNWVPTSGSNVPPG--AFPGGETEDGEPLYIGRVRHEGSLTTGKVQQ 419
           G P N  P+ G+  PPG    PGG   DG+P   G     G++T    QQ
Sbjct: 190 GAPGN-TPSGGAAGPPGPPGPPGGPGNDGQPGGPGNPGAPGAVTEVPGQQ 238


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.318    0.140    0.459 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,275,338
Number of Sequences: 27539
Number of extensions: 519988
Number of successful extensions: 796
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 796
Number of HSP's gapped (non-prelim): 1
length of query: 443
length of database: 12,573,161
effective HSP length: 84
effective length of query: 359
effective length of database: 10,259,885
effective search space: 3683298715
effective search space used: 3683298715
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 61 (28.7 bits)