GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002600-TA|BGIBMGA002600-PA|undefined
         (250 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB209783-1|BAD93020.1|  523|Homo sapiens Fas-activated serine/th...    32   1.7  

>AB209783-1|BAD93020.1|  523|Homo sapiens Fas-activated
           serine/threonine kinase isoform 1 variant protein.
          Length = 523

 Score = 32.3 bits (70), Expect = 1.7
 Identities = 22/54 (40%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 7   CLCLATILKIVSAAPSGFAFPDQRRERKLEPVITPPVLPVLEHLERDPSTLLPH 60
           CL LA +L   S  P   A   +RR R L P   PP+ P+L   E  P  L PH
Sbjct: 162 CLHLAVLLGFPSDGPLVCALEQERRLR-LPPKPPPPLQPLLR--EARPEELTPH 212


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.319    0.140    0.421 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,184,280
Number of Sequences: 224733
Number of extensions: 1156654
Number of successful extensions: 1798
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1798
Number of HSP's gapped (non-prelim): 1
length of query: 250
length of database: 73,234,838
effective HSP length: 88
effective length of query: 162
effective length of database: 53,458,334
effective search space: 8660250108
effective search space used: 8660250108
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 64 (29.9 bits)