SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002593-TA|BGIBMGA002593-PA|IPR002471|Peptidase S9,
serine active site, IPR002470|Peptidase S9A, prolyl oligopeptidase,
IPR004106|Peptidase S9A, prolyl oligopeptidase, N-terminal
beta-propeller, IPR001375|Peptidase S9, prolyl oligopeptidase active
site region
         (396 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      24   2.6  

>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 23.8 bits (49), Expect = 2.6
 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 4/47 (8%)

Query: 58  IQTFPLDVGSVVGFTGKKNQTEIFYHFMSFLTPGVIYHVDFKQKPYT 104
           +Q  P  V      T +KN  E+F+H    +    +YH +  QK  T
Sbjct: 19  VQAVPNKVADKTYVTRQKNIYELFWH----VDQPTVYHPELYQKART 61


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.139    0.421 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,529
Number of Sequences: 429
Number of extensions: 5467
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 396
length of database: 140,377
effective HSP length: 59
effective length of query: 337
effective length of database: 115,066
effective search space: 38777242
effective search space used: 38777242
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)

- SilkBase 1999-2023 -