GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002583-TA|BGIBMGA002583-PA|undefined
         (82 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC30D10.06 |lsm4||U6 snRNP-associated protein Lsm4|Schizosacch...    24   3.0  

>SPBC30D10.06 |lsm4||U6 snRNP-associated protein
           Lsm4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 121

 Score = 23.8 bits (49), Expect = 3.0
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 35  LSKWRAHDSTYYGLRWRFRNQRQRGNAFATHP 66
           ++K +A      G R+R R QR RGN   T P
Sbjct: 79  VAKQQAQQRENRGSRFRGRGQRGRGNYGHTAP 110


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.322    0.130    0.431 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 314,196
Number of Sequences: 5004
Number of extensions: 7893
Number of successful extensions: 14
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 1
length of query: 82
length of database: 2,362,478
effective HSP length: 60
effective length of query: 22
effective length of database: 2,062,238
effective search space: 45369236
effective search space used: 45369236
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 45 (22.2 bits)