SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002583-TA|BGIBMGA002583-PA|undefined
         (82 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_07_0305 - 42631214-42631330,42631423-42631527,42633208-426332...    25   7.6  

>01_07_0305 -
           42631214-42631330,42631423-42631527,42633208-42633216,
           42635198-42636142,42636349-42636450,42637210-42637302
          Length = 456

 Score = 25.0 bits (52), Expect = 7.6
 Identities = 12/32 (37%), Positives = 15/32 (46%)

Query: 39  RAHDSTYYGLRWRFRNQRQRGNAFATHPLCLK 70
           RA + +     WR R  RQRG     HP  L+
Sbjct: 294 RAPNDSICAALWRRRGWRQRGRRSPAHPPWLR 325


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.322    0.130    0.431 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,078,488
Number of Sequences: 37544
Number of extensions: 52964
Number of successful extensions: 59
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 58
Number of HSP's gapped (non-prelim): 1
length of query: 82
length of database: 14,793,348
effective HSP length: 61
effective length of query: 21
effective length of database: 12,503,164
effective search space: 262566444
effective search space used: 262566444
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -