BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002579-TA|BGIBMGA002579-PA|undefined
(115 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 21 8.4
>AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein
protein.
Length = 400
Score = 21.4 bits (43), Expect = 8.4
Identities = 10/33 (30%), Positives = 18/33 (54%)
Query: 63 LETLKNNIRHECENLSPEVLAEVLAEVMKNSIK 95
+ TL ++ E +L LAE +AE +K ++
Sbjct: 241 VRTLAPSVMIEITHLDEITLAEEIAEALKQQLE 273
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.322 0.135 0.393
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,216
Number of Sequences: 2123
Number of extensions: 3814
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 115
length of database: 516,269
effective HSP length: 56
effective length of query: 59
effective length of database: 397,381
effective search space: 23445479
effective search space used: 23445479
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)
- SilkBase 1999-2023 -