SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002579-TA|BGIBMGA002579-PA|undefined
         (115 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090819-1|BAC57913.1|  400|Anopheles gambiae gag-like protein p...    21   8.4  

>AB090819-1|BAC57913.1|  400|Anopheles gambiae gag-like protein
           protein.
          Length = 400

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 63  LETLKNNIRHECENLSPEVLAEVLAEVMKNSIK 95
           + TL  ++  E  +L    LAE +AE +K  ++
Sbjct: 241 VRTLAPSVMIEITHLDEITLAEEIAEALKQQLE 273


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.322    0.135    0.393 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,216
Number of Sequences: 2123
Number of extensions: 3814
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 115
length of database: 516,269
effective HSP length: 56
effective length of query: 59
effective length of database: 397,381
effective search space: 23445479
effective search space used: 23445479
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)

- SilkBase 1999-2023 -