GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002576-TA|BGIBMGA002576-PA|IPR012258|Acyl-CoA oxidase,
IPR009100|Acyl-CoA dehydrogenase/oxidase, middle and N-terminal,
IPR009075|Acyl-CoA dehydrogenase/oxidase C-terminal,
IPR006091|Acyl-CoA dehydrogenase/oxidase, central region,
IPR002655|Acyl-CoA oxidase, C-terminal
         (654 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    25   1.2  

>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 25.4 bits (53), Expect = 1.2
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 529 RKETVRLTANSSPNVKTVMDQLNMLYLSHWALERTG 564
           RK T +L   +SP  K V     + Y++ W+ +R G
Sbjct: 502 RKPTKKLHLKNSPISKKVRPPQVLCYITSWSQKRPG 537


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.319    0.134    0.398 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 149,568
Number of Sequences: 317
Number of extensions: 6413
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 1
length of query: 654
length of database: 114,650
effective HSP length: 61
effective length of query: 593
effective length of database: 95,313
effective search space: 56520609
effective search space used: 56520609
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)