GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002576-TA|BGIBMGA002576-PA|IPR012258|Acyl-CoA oxidase,
IPR009100|Acyl-CoA dehydrogenase/oxidase, middle and N-terminal,
IPR009075|Acyl-CoA dehydrogenase/oxidase C-terminal,
IPR006091|Acyl-CoA dehydrogenase/oxidase, central region,
IPR002655|Acyl-CoA oxidase, C-terminal
         (654 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    27   0.64 

>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 26.6 bits (56), Expect = 0.64
 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%)

Query: 287 YGTMVFVRVMLVNEVAFNLAKAATIAVREPEPQILDYVTQQH 328
           Y  MV  R+ L   + F +  A TI +    P I +YV Q H
Sbjct: 473 YVAMVIDRLQLY--IFFLVTTAGTIGILMDAPHIFEYVDQDH 512


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.134    0.398 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,724
Number of Sequences: 429
Number of extensions: 8320
Number of successful extensions: 18
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 17
Number of HSP's gapped (non-prelim): 1
length of query: 654
length of database: 140,377
effective HSP length: 62
effective length of query: 592
effective length of database: 113,779
effective search space: 67357168
effective search space used: 67357168
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 47 (23.0 bits)