GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002573-TA|BGIBMGA002573-PA|IPR006091|Acyl-CoA
dehydrogenase/oxidase, central region, IPR002655|Acyl-CoA oxidase,
C-terminal, IPR012258|Acyl-CoA oxidase, IPR009100|Acyl-CoA
dehydrogenase/oxidase, middle and N-terminal, IPR009075|Acyl-CoA
dehydrogenase/oxidase C-terminal
         (686 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF264718-1|AAF75271.1|  125|Tribolium castaneum putative cytochr...    25   1.7  

>AF264718-1|AAF75271.1|  125|Tribolium castaneum putative cytochrome
           P450 monooxigenaseCYP4Q6 protein.
          Length = 125

 Score = 25.0 bits (52), Expect = 1.7
 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 474 DTLKLTPTVAYLRTTLTEGFNDKWDNTV-EGIIKGFQTVSMRKISE 518
           +TL+L P+V ++    +E F  K  NT+ EG +       + + +E
Sbjct: 53  ETLRLFPSVPFISRYASEDFVTKTGNTIPEGTVLHIHIFDLHRNAE 98


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.134    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 149,102
Number of Sequences: 317
Number of extensions: 6216
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 686
length of database: 114,650
effective HSP length: 61
effective length of query: 625
effective length of database: 95,313
effective search space: 59570625
effective search space used: 59570625
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 46 (22.6 bits)