BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002572-TA|BGIBMGA002572-PA|IPR000196|Ribosomal protein
L19e
(235 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 7.8
>AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450
CYP12F2 protein.
Length = 522
Score = 23.0 bits (47), Expect = 7.8
Identities = 12/31 (38%), Positives = 19/31 (61%)
Query: 69 NTNSRQNIRKMIKDGLVIKKPVAVHSRARVR 99
N ++ +R IK+GL + +PVA + RA R
Sbjct: 370 NMHNLPYLRACIKEGLRMYQPVAGNMRAAGR 400
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.320 0.132 0.387
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,795
Number of Sequences: 2123
Number of extensions: 4893
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7
Number of HSP's gapped (non-prelim): 1
length of query: 235
length of database: 516,269
effective HSP length: 62
effective length of query: 173
effective length of database: 384,643
effective search space: 66543239
effective search space used: 66543239
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 47 (23.0 bits)
- SilkBase 1999-2023 -