GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002554-TA|BGIBMGA002554-PA|undefined
         (86 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter...    23   0.53 
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    19   6.6  
AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.             19   6.6  

>AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter
           Am-EAAT protein.
          Length = 543

 Score = 23.0 bits (47), Expect = 0.53
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 1   MNESNGYCARITFPLFAPSTVVNQKGGAITETVGA 35
           + E+N   +R+T  + A    VN  G A+ E V A
Sbjct: 374 LEENNKIDSRVTRFVVAVGATVNMDGTALYEAVAA 408


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
          protein.
          Length = 1124

 Score = 19.4 bits (38), Expect = 6.6
 Identities = 6/9 (66%), Positives = 8/9 (88%)

Query: 2  NESNGYCAR 10
          +ES+GYC R
Sbjct: 41 SESSGYCGR 49


>AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.
          Length = 289

 Score = 19.4 bits (38), Expect = 6.6
 Identities = 6/9 (66%), Positives = 8/9 (88%)

Query: 2  NESNGYCAR 10
          +ES+GYC R
Sbjct: 41 SESSGYCGR 49


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.131    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,566
Number of Sequences: 429
Number of extensions: 655
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of query: 86
length of database: 140,377
effective HSP length: 48
effective length of query: 38
effective length of database: 119,785
effective search space:  4551830
effective search space used:  4551830
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (20.0 bits)
S2: 37 (19.0 bits)