GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002550-TA|BGIBMGA002550-PA|IPR001873|Na+ channel,
amiloride-sensitive
         (341 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    22   8.8  

>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 21.8 bits (44), Expect = 8.8
 Identities = 11/47 (23%), Positives = 24/47 (51%)

Query: 205 WVQILSSPQVYIHGPSEVPDVATKNMYSEKDFYLKLYVTAVAIYTTS 251
           W++  + P     G + +  +AT+N  S++      YV A+ ++ +S
Sbjct: 236 WIKPEAIPARVTLGVTSLLTLATQNTQSQQSLPPVSYVKAIDVWMSS 282


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.137    0.430 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,472
Number of Sequences: 429
Number of extensions: 3788
Number of successful extensions: 10
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 9
Number of HSP's gapped (non-prelim): 1
length of query: 341
length of database: 140,377
effective HSP length: 58
effective length of query: 283
effective length of database: 115,495
effective search space: 32685085
effective search space used: 32685085
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 44 (21.8 bits)