BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002546-TA|BGIBMGA002546-PA|IPR000181|Formylmethionine
deformylase
(177 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 6.8
>AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9
methyltransferase protein.
Length = 683
Score = 21.0 bits (42), Expect = 6.8
Identities = 7/37 (18%), Positives = 20/37 (54%)
Query: 33 DPTLRKVSEPVPIENIKTKEIQTLILKLRFVMNKYKS 69
D + K +EN+K KE++ ++ ++ + ++ +
Sbjct: 194 DSDIEKYKMFCNLENVKLKELRIILEDIKHINTRHNT 230
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.320 0.135 0.406
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 54,292
Number of Sequences: 429
Number of extensions: 2268
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 177
length of database: 140,377
effective HSP length: 54
effective length of query: 123
effective length of database: 117,211
effective search space: 14416953
effective search space used: 14416953
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 41 (20.6 bits)
- SilkBase 1999-2023 -