SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002536-TA|BGIBMGA002536-PA|undefined
         (59 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Triboliu...    18   6.8  

>S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Tribolium
           castaneum homeodomainprotein mRNA, complete cds. ).
          Length = 327

 Score = 18.2 bits (35), Expect = 6.8
 Identities = 9/36 (25%), Positives = 11/36 (30%)

Query: 17  GAPNATRRRPDASXXXXXXXXXXXXXXXXXYYDEER 52
           GAP A  +RP  +                 Y  E R
Sbjct: 222 GAPTAEEKRPRTAFSGAQLARLKHEFAENRYLTERR 257


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.313    0.131    0.379 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6699
Number of Sequences: 317
Number of extensions: 82
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 59
length of database: 114,650
effective HSP length: 39
effective length of query: 20
effective length of database: 102,287
effective search space:  2045740
effective search space used:  2045740
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 34 (18.3 bits)
S2: 34 (17.8 bits)

- SilkBase 1999-2023 -