GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002531-TA|BGIBMGA002531-PA|IPR001548|Peptidase M2,
peptidyl-dipeptidase A
         (153 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces po...    25   3.8  

>SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 793

 Score = 25.4 bits (53), Expect = 3.8
 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%)

Query: 71  RLNGEAMRDYFRPLEDWLSSEN-LRTGEFLGWSYDGDYCKF 110
           RL  +   D F  L DW+  E  L +   + WS D D   F
Sbjct: 202 RLTYDGTVDVFNGLTDWIYEEEVLSSPSTIWWSPDSDKIAF 242


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.325    0.141    0.446 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 678,609
Number of Sequences: 5004
Number of extensions: 26282
Number of successful extensions: 61
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 61
Number of HSP's gapped (non-prelim): 2
length of query: 153
length of database: 2,362,478
effective HSP length: 67
effective length of query: 86
effective length of database: 2,027,210
effective search space: 174340060
effective search space used: 174340060
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 50 (24.2 bits)