BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002531-TA|BGIBMGA002531-PA|IPR001548|Peptidase M2,
peptidyl-dipeptidase A
(153 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces po... 25 3.8
>SPACUNK4.08 |||dipeptidyl aminopeptidase |Schizosaccharomyces
pombe|chr 1|||Manual
Length = 793
Score = 25.4 bits (53), Expect = 3.8
Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%)
Query: 71 RLNGEAMRDYFRPLEDWLSSEN-LRTGEFLGWSYDGDYCKF 110
RL + D F L DW+ E L + + WS D D F
Sbjct: 202 RLTYDGTVDVFNGLTDWIYEEEVLSSPSTIWWSPDSDKIAF 242
Database: spombe
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.325 0.141 0.446
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 678,609
Number of Sequences: 5004
Number of extensions: 26282
Number of successful extensions: 61
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 61
Number of HSP's gapped (non-prelim): 2
length of query: 153
length of database: 2,362,478
effective HSP length: 67
effective length of query: 86
effective length of database: 2,027,210
effective search space: 174340060
effective search space used: 174340060
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 50 (24.2 bits)
- SilkBase 1999-2023 -