GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002526-TA|BGIBMGA002526-PA|IPR006025|Peptidase M,
neutral zinc metallopeptidases, zinc-binding site, IPR001548|Peptidase
M2, peptidyl-dipeptidase A
         (648 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB183889-1|BAD86829.1|  316|Apis mellifera Mos protein.                23   7.8  

>AB183889-1|BAD86829.1|  316|Apis mellifera Mos protein.
          Length = 316

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 315 DEFFRSLNLTAMPEKFWKNSIIEKPTDREIV 345
           D+ F+    T + ++ W  +I E+PT  E++
Sbjct: 278 DDEFKGTYKT-LYKQMWSQNITERPTTNEVI 307


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.317    0.132    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 195,627
Number of Sequences: 429
Number of extensions: 8868
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 1
length of query: 648
length of database: 140,377
effective HSP length: 62
effective length of query: 586
effective length of database: 113,779
effective search space: 66674494
effective search space used: 66674494
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 47 (23.0 bits)