GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002510-TA|BGIBMGA002510-PA|undefined
         (320 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578797-1|AAT07302.1|  304|Anopheles gambiae activin protein.         29   0.17 

>AY578797-1|AAT07302.1|  304|Anopheles gambiae activin protein.
          Length = 304

 Score = 29.1 bits (62), Expect = 0.17
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 124 SPRVSVVDINEPRLTREKLSYNQSNNDDNDMPDAFSSL 161
           +PR SVV    P+    K++Y +  +DD + P  F SL
Sbjct: 121 APR-SVVKAKHPKSQERKVAYGEGTDDDYNRPHLFVSL 157


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.312    0.127    0.362 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 292,029
Number of Sequences: 2123
Number of extensions: 11043
Number of successful extensions: 14
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 1
length of query: 320
length of database: 516,269
effective HSP length: 64
effective length of query: 256
effective length of database: 380,397
effective search space: 97381632
effective search space used: 97381632
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 48 (23.4 bits)