BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002496-TA|BGIBMGA002496-PA|IPR006876|LMBR1-like
conserved region
(374 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 22 8.2
>AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450
monooxygenase protein.
Length = 127
Score = 21.8 bits (44), Expect = 8.2
Identities = 11/43 (25%), Positives = 20/43 (46%)
Query: 318 VRRELYNRFKWMADFFSVPEDSKTVIDMLSITQLQDRTIAPDK 360
+ R+L K + ++VP VI + +L++ PDK
Sbjct: 65 IARQLNQDLKLASGDYTVPAGCTVVIGTFKVHRLEEYYPNPDK 107
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.319 0.134 0.379
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 68,450
Number of Sequences: 317
Number of extensions: 2404
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 374
length of database: 114,650
effective HSP length: 58
effective length of query: 316
effective length of database: 96,264
effective search space: 30419424
effective search space used: 30419424
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -