BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002486-TA|BGIBMGA002486-PA|IPR001382|Glycoside
hydrolase, family 47
(539 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 24 2.3
>EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D
protein.
Length = 255
Score = 24.2 bits (50), Expect = 2.3
Identities = 11/45 (24%), Positives = 19/45 (42%)
Query: 173 LTGDTIFRDKAAEVADALLPAFETPTGLPYALINQSTKASRQYHW 217
+ GD + D+ E + ++ P GL +A N+ Y W
Sbjct: 35 VVGDETYCDRYWECVNGQQELYDCPNGLVFAGKNRGVTEGCDYPW 79
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.318 0.133 0.397
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 117,456
Number of Sequences: 317
Number of extensions: 4394
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 539
length of database: 114,650
effective HSP length: 60
effective length of query: 479
effective length of database: 95,630
effective search space: 45806770
effective search space used: 45806770
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 45 (22.2 bits)
- SilkBase 1999-2023 -