GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002486-TA|BGIBMGA002486-PA|IPR001382|Glycoside
hydrolase, family 47
         (539 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    24   2.3  

>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 24.2 bits (50), Expect = 2.3
 Identities = 11/45 (24%), Positives = 19/45 (42%)

Query: 173 LTGDTIFRDKAAEVADALLPAFETPTGLPYALINQSTKASRQYHW 217
           + GD  + D+  E  +     ++ P GL +A  N+       Y W
Sbjct: 35  VVGDETYCDRYWECVNGQQELYDCPNGLVFAGKNRGVTEGCDYPW 79


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.133    0.397 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 117,456
Number of Sequences: 317
Number of extensions: 4394
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 539
length of database: 114,650
effective HSP length: 60
effective length of query: 479
effective length of database: 95,630
effective search space: 45806770
effective search space used: 45806770
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 45 (22.2 bits)