GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002482-TA|BGIBMGA002482-PA|IPR010994|RuvA domain 2-like,
IPR004579|DNA repair protein rad10
         (278 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    24   1.4  

>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 13/54 (24%), Positives = 28/54 (51%)

Query: 90  LFLSLRYHNLNPDYIHNRLKELGKKYDLRVLLVQVDLKDPHASLKNLTRICLLT 143
           +FL   ++N N + IH++L +L   + + + LV +     + +L  + +  L T
Sbjct: 417 IFLITPFYNFNENTIHSKLCKLYATFLIALKLVWIVALFKNENLSEMVKQFLFT 470


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.315    0.135    0.385 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 63,957
Number of Sequences: 317
Number of extensions: 2660
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 278
length of database: 114,650
effective HSP length: 56
effective length of query: 222
effective length of database: 96,898
effective search space: 21511356
effective search space used: 21511356
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 43 (21.4 bits)