GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002470-TA|BGIBMGA002470-PA|IPR005024|Snf7
         (225 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    24   0.84 

>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 24.2 bits (50), Expect = 0.84
 Identities = 11/33 (33%), Positives = 14/33 (42%)

Query: 188 KAPAAPDREPGADSIRNKDGVPVDEFGLPQVPS 220
           K+P+   R P    +  KDG  V E      PS
Sbjct: 695 KSPSPQQRSPSVTDLSTKDGTTVPESNNGSSPS 727


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.311    0.128    0.354 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 42,929
Number of Sequences: 317
Number of extensions: 1492
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 225
length of database: 114,650
effective HSP length: 55
effective length of query: 170
effective length of database: 97,215
effective search space: 16526550
effective search space used: 16526550
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 42 (21.0 bits)