SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002458-TA|BGIBMGA002458-PA|IPR000276|Rhodopsin-like GPCR
superfamily, IPR000611|Neuropeptide Y receptor
         (251 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_06_0171 - 26127547-26127592,26127955-26128079,26128187-261283...    31   0.89 

>05_06_0171 -
           26127547-26127592,26127955-26128079,26128187-26128336,
           26128738-26128827,26129012-26129251,26129735-26130394
          Length = 436

 Score = 31.1 bits (67), Expect = 0.89
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 164 LQLSKRKVLWTLHEGDEDWAVWPGMPYVWFASH-WLAMSHSCYNPLIYCYMNAKYRHG 220
           + LSK+ +LW  +  D    +    P +W     W+ MS  C NP+   +M+ ++ +G
Sbjct: 285 IHLSKQHLLW--YGYDRKNKMHSLCPAIWSKHRRWMVMSMMCLNPVTCSFMDVQFPNG 340


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.328    0.139    0.482 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,465,661
Number of Sequences: 37544
Number of extensions: 239913
Number of successful extensions: 578
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 578
Number of HSP's gapped (non-prelim): 1
length of query: 251
length of database: 14,793,348
effective HSP length: 80
effective length of query: 171
effective length of database: 11,789,828
effective search space: 2016060588
effective search space used: 2016060588
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 59 (27.9 bits)

- SilkBase 1999-2023 -