BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002458-TA|BGIBMGA002458-PA|IPR000276|Rhodopsin-like GPCR
superfamily, IPR000611|Neuropeptide Y receptor
(251 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
05_06_0171 - 26127547-26127592,26127955-26128079,26128187-261283... 31 0.89
>05_06_0171 -
26127547-26127592,26127955-26128079,26128187-26128336,
26128738-26128827,26129012-26129251,26129735-26130394
Length = 436
Score = 31.1 bits (67), Expect = 0.89
Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 3/58 (5%)
Query: 164 LQLSKRKVLWTLHEGDEDWAVWPGMPYVWFASH-WLAMSHSCYNPLIYCYMNAKYRHG 220
+ LSK+ +LW + D + P +W W+ MS C NP+ +M+ ++ +G
Sbjct: 285 IHLSKQHLLW--YGYDRKNKMHSLCPAIWSKHRRWMVMSMMCLNPVTCSFMDVQFPNG 340
Database: rice
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.328 0.139 0.482
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,465,661
Number of Sequences: 37544
Number of extensions: 239913
Number of successful extensions: 578
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 578
Number of HSP's gapped (non-prelim): 1
length of query: 251
length of database: 14,793,348
effective HSP length: 80
effective length of query: 171
effective length of database: 11,789,828
effective search space: 2016060588
effective search space used: 2016060588
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 59 (27.9 bits)
- SilkBase 1999-2023 -