GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002456-TA|BGIBMGA002456-PA|IPR001452|Src homology-3,
IPR000108|Neutrophil cytosol factor 2
         (817 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           25   3.3  

>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 24.6 bits (51), Expect = 3.3
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 15  TVNFAYDASEADELTIRPGDVIRDVERLPGGW--WRGEL 51
           T+++ YD+ EA +  I  GD I +   LP G   WR ++
Sbjct: 162 TIDYTYDSIEARDSAIFDGDFITE-NNLPLGLEVWRDKV 199


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.313    0.129    0.369 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 185,732
Number of Sequences: 429
Number of extensions: 7058
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 7
Number of HSP's gapped (non-prelim): 2
length of query: 817
length of database: 140,377
effective HSP length: 63
effective length of query: 754
effective length of database: 113,350
effective search space: 85465900
effective search space used: 85465900
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 48 (23.4 bits)