GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002428-TA|BGIBMGA002428-PA|undefined
         (915 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    23   8.5  

>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 23.4 bits (48), Expect = 8.5
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 46  KPAFLSDKALESSIKHIVRRFPNIDV--KGLQAITPIRNEM 84
           K  ++ +  LE  IKH + R   ID+  K L+++    NEM
Sbjct: 348 KQKYVKNSKLEKVIKHDILRMLIIDLRKKQLKSLEDWENEM 388


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.323    0.136    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 241,040
Number of Sequences: 429
Number of extensions: 9476
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 1
length of query: 915
length of database: 140,377
effective HSP length: 64
effective length of query: 851
effective length of database: 112,921
effective search space: 96095771
effective search space used: 96095771
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 48 (23.4 bits)