SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002425-TA|BGIBMGA002425-PA|undefined
         (58 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ...    25   6.4  

>At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative
           similar to gb|U90212 DNA binding protein ACBF from
           Nicotiana tabacum and contains 3 PF|00076 RNA
           recognition motif domains. ESTs gb|T44278, gb|R65195,
           gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278,
           gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1
          Length = 405

 Score = 25.0 bits (52), Expect = 6.4
 Identities = 12/40 (30%), Positives = 21/40 (52%)

Query: 10  LPAGRRCSALARNLHCRPESDAQLWLGICIAGRKVMLSFG 49
           +PAG+RC  +  +     E   ++  G+ + G  V LS+G
Sbjct: 292 IPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLSWG 331


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.327    0.138    0.444 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,382,458
Number of Sequences: 28952
Number of extensions: 39131
Number of successful extensions: 66
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 65
Number of HSP's gapped (non-prelim): 1
length of query: 58
length of database: 12,070,560
effective HSP length: 38
effective length of query: 20
effective length of database: 10,970,384
effective search space: 219407680
effective search space used: 219407680
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -