GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002417-TA|BGIBMGA002417-PA|IPR010733|Protein of unknown
function DUF1308
         (404 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    23   6.1  

>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 22.6 bits (46), Expect = 6.1
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 5/53 (9%)

Query: 220 IPELNHGIDHSEIKTLNLDVTTMMAYVSNMTNGHHNFIFKQEVLTQQCSWEAE 272
           +P +  G+D S    L+ DVT    Y   +    HN +F Q  + +Q  + AE
Sbjct: 427 LPTVMSGLDES----LS-DVTPRKKYPFELEKALHNVMFIQHHIQRQDEFNAE 474


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.137    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,440
Number of Sequences: 429
Number of extensions: 4022
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 404
length of database: 140,377
effective HSP length: 59
effective length of query: 345
effective length of database: 115,066
effective search space: 39697770
effective search space used: 39697770
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)