GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002405-TA|BGIBMGA002405-PA|IPR001971|Ribosomal protein
S11
         (151 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z69742-1|CAA93624.1|   72|Tribolium castaneum arylphorin protein.      24   0.65 

>Z69742-1|CAA93624.1|   72|Tribolium castaneum arylphorin protein.
          Length = 72

 Score = 23.8 bits (49), Expect = 0.65
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 20 QHLVGETVFGVAHIFASFNDTFVHVTDLSGRETI 53
          +H+VG  V  V  ++ SFN T  +V D   RE I
Sbjct: 21 EHMVGTIVVVVRGVWVSFNQTAQNV-DTFVREQI 53


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.131    0.365 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,161
Number of Sequences: 317
Number of extensions: 628
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 151
length of database: 114,650
effective HSP length: 52
effective length of query: 99
effective length of database: 98,166
effective search space:  9718434
effective search space used:  9718434
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.3 bits)
S2: 40 (20.2 bits)