BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA002405-TA|BGIBMGA002405-PA|IPR001971|Ribosomal protein
S11
(151 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 4.2
>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
precursor protein.
Length = 1623
Score = 23.0 bits (47), Expect = 4.2
Identities = 9/30 (30%), Positives = 17/30 (56%)
Query: 8 VAKEEVQVTLGPQHLVGETVFGVAHIFASF 37
V ++++TL + G+ VFG A + S+
Sbjct: 240 VTATDIRITLDRLNTFGDEVFGDAQVLKSY 269
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.318 0.131 0.365
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,848
Number of Sequences: 2123
Number of extensions: 3156
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 151
length of database: 516,269
effective HSP length: 59
effective length of query: 92
effective length of database: 391,012
effective search space: 35973104
effective search space used: 35973104
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -