GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002401-TA|BGIBMGA002401-PA|IPR000092|Polyprenyl
synthetase, IPR008949|Terpenoid synthase
         (307 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine vasopre...    23   2.1  

>EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine
           vasopressin receptor protein.
          Length = 403

 Score = 23.4 bits (48), Expect = 2.1
 Identities = 15/45 (33%), Positives = 21/45 (46%)

Query: 217 VLHLSIISFDRTKLDILRQRTRDVEVKRYCITLLEKLGSFRYTRG 261
           +LHLSI       L +L Q   D+  + Y   LL K+  +  T G
Sbjct: 79  ILHLSIADLITAFLSVLPQLAWDITYRFYGGFLLCKVVKYGQTLG 123


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.137    0.397 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 67,477
Number of Sequences: 317
Number of extensions: 2575
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 307
length of database: 114,650
effective HSP length: 57
effective length of query: 250
effective length of database: 96,581
effective search space: 24145250
effective search space used: 24145250
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)