SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA002388-TA|BGIBMGA002388-PA|undefined
         (142 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_03_0655 + 18436363-18436901,18436984-18437772,18437952-184380...    31   0.35 

>04_03_0655 +
           18436363-18436901,18436984-18437772,18437952-18438028,
           18438034-18438248
          Length = 539

 Score = 31.1 bits (67), Expect = 0.35
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 1/57 (1%)

Query: 82  LLEDVPLTDRRHINEMWLPSALRTASKRFPGPGISGKVDWTFRHYLVASSFPRFKSP 138
           L  DVP   R H++     S +  A    PGP    K+DW  R   +AS   RF  P
Sbjct: 289 LFRDVPRLRRVHLSFSLDSSTVDDAQHPLPGPD-KYKLDWHVRSERMASLVVRFTGP 344


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.325    0.139    0.427 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,771,749
Number of Sequences: 37544
Number of extensions: 133732
Number of successful extensions: 259
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 259
Number of HSP's gapped (non-prelim): 1
length of query: 142
length of database: 14,793,348
effective HSP length: 75
effective length of query: 67
effective length of database: 11,977,548
effective search space: 802495716
effective search space used: 802495716
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 56 (26.6 bits)

- SilkBase 1999-2023 -